PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02350.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family HD-ZIP
Protein Properties Length: 278aa    MW: 31697.1 Da    PI: 8.3835
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02350.1_g00007.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.82.1e-19114168256
                              T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                 Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                              rk+ ++tkeq  +Le+ F+ +++++ +++  LAkklgL  rqV vWFqNrRa+ k
  Sme2.5_02350.1_g00007.1 114 RKKLRLTKEQSAILEDTFKHHHTLNPKQKLALAKKLGLRPRQVEVWFQNRRARTK 168
                              678899***********************************************98 PP

2HD-ZIP_I/II125.23.1e-40114203191
              HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekevee 86 
                              +kk+rl+keq+++LE++F+++++L+p++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l+een+rL+ke +e
  Sme2.5_02350.1_g00007.1 114 RKKLRLTKEQSAILEDTFKHHHTLNPKQKLALAKKLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCVENLTEENRRLQKEAQE 199
                              69************************************************************************************ PP

              HD-ZIP_I/II  87 Lreel 91 
                              Lr +l
  Sme2.5_02350.1_g00007.1 200 LR-SL 203
                              *9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.4E-14189IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466894.6E-19107171IPR009057Homeodomain-like
PROSITE profilePS5007117.022110170IPR001356Homeobox domain
SMARTSM003891.8E-17112174IPR001356Homeobox domain
CDDcd000867.25E-16114171No hitNo description
PfamPF000468.1E-17114168IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-18119168IPR009057Homeodomain-like
PRINTSPR000311.9E-5141150IPR000047Helix-turn-helix motif
PROSITE patternPS000270145168IPR017970Homeobox, conserved site
PRINTSPR000311.9E-5150166IPR000047Helix-turn-helix motif
SMARTSM003401.4E-23170213IPR003106Leucine zipper, homeobox-associated
PfamPF021832.2E-8170204IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MMEQEDLGLR LSLRFPAEKT TTIAINHPMQ LNLIPSTIIS PSPAPPPAFN NYWTTHSSTD  60
GKTETRSFLK GIDVNRMPET AEEEEGGVSL SGNKRSENEM ERAISDEEDG ETCRKKLRLT  120
KEQSAILEDT FKHHHTLNPK QKLALAKKLG LRPRQVEVWF QNRRARTKLK QTEVDCEFLK  180
KCVENLTEEN RRLQKEAQEL RSLKHSPQFY MRMTPPITLT MCPSCERVAS SGPTNTPVNV  240
LPHRVGPPHQ PMPLNMWGPI SQGQYDQMDS CPTLARQN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1162170RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015077450.11e-144PREDICTED: homeobox-leucine zipper protein HAT4
SwissprotQ054668e-85HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLK4C6R31e-142K4C6R3_SOLLC; Uncharacterized protein
STRINGSolyc06g060830.2.11e-142(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.11e-77homeobox protein 2